DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG18223

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:210 Identity:64/210 - (30%)
Similarity:104/210 - (49%) Gaps:15/210 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DNAHVCGGSILSQTKILTTAHCVHRDGKLIDASR-LACRVGSTNQYAG--GKIVNVESVAVH-PD 106
            || |.|||.|:|:|.|||:|||.....|::..|| |....|:||:...  |..:|:|...:. ||
  Fly    75 DN-HFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPD 138

  Fly   107 YYNL--NNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRT-SDGTNSYKIRQI 168
            .:.:  .||:|::.|:.:|...:.:..:..:.:.:  |..|....|.||||. ..|..:..|..|
  Fly   139 KFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTAD--PEPGLNYTVLGWGRIFKGGPLASDILHI 201

  Fly   169 SLKVAPEATCLDAYSDHDEQSFC---LAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSR- 229
            .:::.|...|........|:..|   |.:.:.|..|.||.|...|:..|:.|:.::.|| |||: 
  Fly   202 DVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVFGVVSYRVG-CGSKT 265

  Fly   230 YPDVFVRLSSYADWI 244
            .|.::..:..:.|||
  Fly   266 LPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 64/210 (30%)
Tryp_SPc 42..244 CDD:214473 62/208 (30%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 64/210 (30%)
Tryp_SPc 60..280 CDD:214473 62/208 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.