DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG7542

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:266 Identity:83/266 - (31%)
Similarity:130/266 - (48%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGLTAVGMCHA-------QGRIMGGEDADATATTFTASLRVDNAH---VCGGSILSQTKILTTA 65
            |:.:..||.|.|       :..|..||.|:.....:.|.|.|...:   .|||:::|...|:|.|
  Fly     5 LVCVLLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAA 69

  Fly    66 HCVHRDGKLIDASRLACRVGSTN----QYAGGKIVNVE--SVAVHPDYY--NLNNNLAVITLSSE 122
            ||:  ||    |..:...:|:.|    ...|.:.:.||  .:.||.:|.  .:.|::::|.|.:.
  Fly    70 HCM--DG----AESVTVYLGAINIGDESEEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAF 128

  Fly   123 LTYTDRITA--IPLVASGEALPAEGSEVIVAGWGRTSDGTNSYK--IRQISLKVAPEATCLDAYS 183
            :.:||||.|  :|...:|:....|......:||||.||.::|..  :|.:.:.:.|.:.|...:|
  Fly   129 VGFTDRIRAASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWS 193

  Fly   184 DH-DEQSFCLAHELKEGTCHGDGGGGAIY--GNT--LIGLTNFVVG-ACGSRYPDVFVRLSSYAD 242
            .. .|:..|::....:.|||||.||..:|  ||:  |||.|:|... .|...:|.||.|:|||.|
  Fly   194 GAVSEKMICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLD 258

  Fly   243 WIQEQI 248
            ||...|
  Fly   259 WILNHI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 72/225 (32%)
Tryp_SPc 42..244 CDD:214473 70/222 (32%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 77/241 (32%)
Tryp_SPc 27..260 CDD:214473 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.