DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG18179

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:242 Identity:54/242 - (22%)
Similarity:99/242 - (40%) Gaps:32/242 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQGRIMGGEDADATATTFTASLRV-----DNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLA 81
            |:|||:.|..|......:...|.:     ::|.|..|:|::...|||.|||:..|       .:.
  Fly    36 AEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTD-------YVE 93

  Fly    82 CRVGSTNQYAGG--KIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAE 144
            ...||...:.|.  :.|..::...||::.........:..:..:.:||.|..:       |||:.
  Fly    94 IHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGRDIGLIRTPSVGFTDLINKV-------ALPSF 151

  Fly   145 GSE--------VIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEGTC 201
            ..|        .:..|||...:|..:..::.:.:::...:.|..:|........|......:.:|
  Fly   152 SEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGKSSC 216

  Fly   202 HGDGGGGAI-YGNT-LIGLTNFVVGACGSRYPDVFVRLSSYADWIQE 246
            .||.||..: :.|. |:|:..|....|.|. |..:.|::.|..||::
  Fly   217 GGDSGGPLVTHDNARLVGVITFGSVDCHSG-PSGYTRVTDYLGWIRD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 48/222 (22%)
Tryp_SPc 42..244 CDD:214473 46/218 (21%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 50/235 (21%)
Tryp_SPc 40..263 CDD:238113 51/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.