DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG3088

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:267 Identity:65/267 - (24%)
Similarity:108/267 - (40%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQPRLVILGLIGLTAVGMCHAQGR-----IMGGEDADATATTFTASLRVDNAHV-CGGSILSQTK 60
            |:..:|.|||. |.|.|.......     |..|..|......:...:....::: |.|:|:..|.
  Fly     1 MKLLVVFLGLT-LVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTW 64

  Fly    61 ILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTY 125
            |||:|.|      |..:|.:....|:|........|.|.:    .:|...|.:||::.: ..:.:
  Fly    65 ILTSAQC------LTGSSGVTIYFGATRLSQAQFTVTVGT----SEYVTGNQHLALVRV-PRVGF 118

  Fly   126 TDRITAIPLVASGEALPA--------EGSEVIVAGWGRT--SDGTNSYKIRQISLKVAPEATCLD 180
            ::|:..:       |||:        |.....|.|||.|  |:|... .::.:.|::.....|:.
  Fly   119 SNRVNRV-------ALPSLRNRSQRYENWWANVCGWGVTTFSNGLTD-ALQCVDLQIMSNNECIA 175

  Fly   181 AYSDH--DEQSFCLAHELKEGTCHGDGGGGAI--YGNTLIGLTNFVV-GACGSRYPDVFVRLSSY 240
            .|...  .:|..|........||.||.|...|  ..:|::|::.||. ..|....|..|.|::|.
  Fly   176 FYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGCTLGLPAGFARITSA 240

  Fly   241 ADWIQEQ 247
            .|||.::
  Fly   241 LDWIHQR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 54/220 (25%)
Tryp_SPc 42..244 CDD:214473 52/217 (24%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 57/235 (24%)
Tryp_SPc 29..244 CDD:214473 55/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471070
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.