DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Jon66Ci

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:242 Identity:65/242 - (26%)
Similarity:109/242 - (45%) Gaps:40/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLI-------DASRL 80
            :|||..|..|:.....:|..|.......|||||:|...:||..||:..|...:       ..::.
  Fly    34 EGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIISNEWVLTAEHCIGGDAVTVYFGATWRTNAQF 98

  Fly    81 ACRVGSTNQYAGGKIVNVESVAV-HPDYYNLNNNLAVITLSSEL-TYTDRITAIPLVASGEALPA 143
            ...|||.|....|. .::..:.: |.|::::.|.:       || :|.||..             
  Fly    99 THWVGSGNFITHGS-ADIALIRIPHVDFWHMVNKV-------ELPSYNDRYN------------- 142

  Fly   144 EGSE--VIVAGWGRTSDGT--NSYKIRQISLKVAPEATCLDAYSDH--DEQSFCLAHELKEGTCH 202
            :.:|  .:..|||.|.||:  ..| ::.:.|::...:.|...|...  .:...|:.....:|||.
  Fly   143 DYNEWWAVACGWGGTYDGSPLPDY-LQCVDLQIIHNSECASYYGTGTVGDNIICVRVVDGKGTCG 206

  Fly   203 GDGGGGAIY--GNTLIGLTNFVVGA-CGSRYPDVFVRLSSYADWIQE 246
            ||.||..:.  |:.|:|:||:|.|| |.:.:|..|.|::.:.|||::
  Fly   207 GDSGGPLVTHDGSKLVGVTNWVSGAGCQAGHPAGFQRVTYHLDWIRD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/223 (26%)
Tryp_SPc 42..244 CDD:214473 57/219 (26%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 62/236 (26%)
Tryp_SPc 37..254 CDD:238113 63/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.