DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG33460

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:244 Identity:52/244 - (21%)
Similarity:94/244 - (38%) Gaps:49/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGG- 93
            |:...:...:||.|..|.:..|.|::::...|||.|.|:.       .:.:..|:|...:|... 
  Fly    36 EEFSTSLGPWTALLHTDGSIFCAGTLITDVFILTAASCIR-------PNAVKVRLGEFGRYPNEL 93

  Fly    94 ------------KIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGS 146
                        ::.|.||:|         ||:.::.|:..:..||.|..:.:|.:.:.......
  Fly    94 PEDHLVHYFLMYRLFNNESLA---------NNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTM 149

  Fly   147 EVIVAGWGRTSDGTNSYKIRQISLKVAPE-ATCLDAYSDHDEQSFCLAHELKEGTCHGDGGGGAI 210
            ..|...|...|:.:.:.::|.|.::..|: .|.||.|:     .||..|:....:|.|..|...|
  Fly   150 RFIGNAWMEDSNVSLTKELRPIVIQSKPKMCTNLDLYT-----QFCAGHQGNLRSCDGLTGSALI 209

  Fly   211 --------YGNTLIGLTNFVVGAC--GSRYPDVFVRLSSYADWIQEQIA 249
                    |.:...|:.......|  ...|.||.    .:..|||:.::
  Fly   210 QNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVL----KFYWWIQDVVS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 49/228 (21%)
Tryp_SPc 42..244 CDD:214473 46/225 (20%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 51/232 (22%)
Tryp_SPc 44..249 CDD:214473 48/229 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.