DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG33465

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:281 Identity:69/281 - (24%)
Similarity:113/281 - (40%) Gaps:55/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLVILGLIGLTAVGMCHAQGRIMGGEDAD------------ATATT-FTASLRVDNAHVCGGSIL 56
            |::.|.||||.   :|....:::..:..|            ||.|. :.||:..:|..:|.|:::
  Fly     3 RVLSLALIGLV---LCQGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLV 64

  Fly    57 SQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYA-GGKIVNVESVAV-----HPDYYNLN--NN 113
            .:..:||.|.|:.:|      |:|....|..|||. ..:..|.|...|     |.::...|  |:
  Fly    65 HKLFVLTAASCISKD------SQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVND 123

  Fly   114 LAVITLSSELTYTDRITAIPLVASG--EALPAEGSEVIVAGWGRTSDGTN-SYKIRQ---ISLKV 172
            :.::.|..|:|:...|..|.::...  ::.|.|..|    |:|....||. |.::||   :|.|.
  Fly   124 IGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFE----GFGWQQQGTEASSQVRQTVYLSQKK 184

  Fly   173 APEATCLDAYSDHDEQSFCLAHELKEGTCHGDGG----GGAIYG----NTLIGLTNFVVGACG-- 227
            ..|..........:|..|| |.......|..:.|    ....||    ...:||.::....|.  
  Fly   185 PFECHRNGQLLPINEGQFC-AGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPT 248

  Fly   228 SRYPDVFVRLSSYADWIQEQI 248
            |.|.||.    ::.|||...:
  Fly   249 SVYTDVV----AFKDWIYNTV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/228 (25%)
Tryp_SPc 42..244 CDD:214473 55/225 (24%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 58/232 (25%)
Tryp_SPc 46..261 CDD:214473 56/229 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.