DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG32374

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:263 Identity:70/263 - (26%)
Similarity:120/263 - (45%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQPRLVILGLIGLT-AVGMCHAQG----RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKI 61
            ::|:..:.|.|... |:....||.    ||:.|:....:...:..:|..:|..:||..||::..|
  Fly    45 IKPQTFLPGNISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWI 109

  Fly    62 LTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELT 124
            ||..||     |:.:..|...|.|||.|..||::.:|:....||:|  |.:.|:|.::.|.:.|.
  Fly   110 LTAQHC-----KIGNPGRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLN 169

  Fly   125 YTDRITAIPLVASGEALPAEGSE-----VIVAGWGRTSDGTNSYK--IRQISLKVAPEATCLDAY 182
            ....:..:       .||:..::     .:.:|||.||....:.:  :|.:.:.....|.|...|
  Fly   170 VGRCVQKV-------KLPSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDY 227

  Fly   183 SDHD----EQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADW 243
            ....    :|..| |......||.||.||..::...|.|:|:|.:|...::||.|:|.:..|..|
  Fly   228 RGTGIKIYKQMIC-AKRKNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRW 291

  Fly   244 IQE 246
            |::
  Fly   292 IKK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/218 (28%)
Tryp_SPc 42..244 CDD:214473 59/214 (28%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 62/231 (27%)
Tryp_SPc 74..295 CDD:238113 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.