DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG16998

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:114/250 - (45%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILGLIGLTAVG----MCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCV 68
            ||.||.|...|    ....|.||:||.:.....|.:.||:.|...:.|..::::...::|..|||
  Fly     3 ILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV 67

  Fly    69 HRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITA 131
            ..      ....:.|.|||....||:..||.||.:|||:  ..|.|::|::.|....|....|..
  Fly    68 QY------PDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQV 126

  Fly   132 IPL-VASGEALPAEGSEVIVAGWGR--TSDGTNSYKIRQISLKVAPEATCLDAYSD-H---DEQS 189
            :.| :.|...||   ..::|||||.  .:|..:..::|...:||..:..|...||. |   .:..
  Fly   127 VKLPLPSLNILP---RTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDM 188

  Fly   190 FCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244
            .|.|...:: .|:||.|...::..:..|:.:|..|.....:|.|:.||::|..||
  Fly   189 VCAAGAGRD-HCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/211 (27%)
Tryp_SPc 42..244 CDD:214473 57/210 (27%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 63/227 (28%)
Tryp_SPc 25..242 CDD:238113 62/226 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.