DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG10469

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:264 Identity:73/264 - (27%)
Similarity:116/264 - (43%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VILGLIGLTAVGMCHAQG----RIMGGEDADATATTFTASL------RVDNAHVCGGSILSQTKI 61
            :||.|:.:....:...|.    |||.|..|.|....:...|      ..|..::|||:|||...|
  Fly     1 MILQLVLIVQFSLVFGQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWI 65

  Fly    62 LTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKI-VNVESVAVHP--DYYNLNNNLAVITLSSEL 123
            :|.|||: :|.| .:..::...||....:...:| ||.....||.  |...:.|::|:|.|..:|
  Fly    66 ITAAHCL-QDPK-SNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKL 128

  Fly   124 TYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATC-------LDA 181
            |:...|....|.::.:..  .|.:.|::|||.|:....|..::.|...:.....|       |..
  Fly   129 TFNKYIQPAKLPSAKKTY--TGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQLGG 191

  Fly   182 YSDHDEQSFCLAHELKEG-TCHGDGGGGAIY---GNTLIGLTNF-VVGACGSRYPDVFVRLSSYA 241
            .|.....:..:..:.|:| .|.||.||..:.   ..||:|:.:. ..|.|..:.|||..|:|||.
  Fly   192 KSKKVVHNGFICIDSKKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYL 256

  Fly   242 DWIQ 245
            .||:
  Fly   257 KWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 63/225 (28%)
Tryp_SPc 42..244 CDD:214473 61/222 (27%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 67/239 (28%)
Tryp_SPc 24..260 CDD:238113 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.