DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:242 Identity:71/242 - (29%)
Similarity:113/242 - (46%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGEDADATATTFTASL---RVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRV 84
            :|||..|:.|.:....:...|   ....:..|||||:..|.:||.|||..      .||.:....
  Fly    37 EGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTS------GASAVTIYY 95

  Fly    85 GSTNQYAGGKI--VNVESVAVHPDYYN--LNNNLAVITLSSELTYTDRITAIPLVA-SGEALPAE 144
            |:|.:.:...:  |:.::...|..|.:  |.|::::|. :..:.:|..|..:.|.| :|......
  Fly    96 GATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALINKVELPAIAGTYSTYT 159

  Fly   145 GSEVIVAGWGRTSDGTNS------YKIRQISLKVAPEATCLDAYSD--HDEQSFCLAHELKEGTC 201
            |.:.|.:|||:|||...|      |::    .:|...:.|.:.|..  ......|:|...|..||
  Fly   160 GQQAIASGWGKTSDSATSVANTLQYEV----FEVVSVSQCQNTYGSLVATNNVICVATPNKVSTC 220

  Fly   202 HGDGGGGAIY--GNTLIGLTNFVVGA-CGSRYPDVFVRLSSYADWIQ 245
            :||.||..:.  .:.|||:|:||..| |.|..|..|.|::||.|||:
  Fly   221 NGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 66/223 (30%)
Tryp_SPc 42..244 CDD:214473 64/220 (29%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 68/237 (29%)
Tryp_SPc 40..269 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.