DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:261 Identity:75/261 - (28%)
Similarity:120/261 - (45%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVD----NAHVCGGSILSQTKILTTAHCV 68
            ::|.||          |||.||.:|......:...|.:.    ::..||||::..|.:||.|||.
  Fly    30 VVGDIG----------GRITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCT 84

  Fly    69 HRDGKLIDASRLACRVGSTNQYAGGKI---------VNVESVAVHPDY--YNLNNNLAVITLSSE 122
              ||           |.|...|.|..:         |:...:.:|..:  .||.|::::|.:.: 
  Fly    85 --DG-----------VQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKIPA- 135

  Fly   123 LTYTDRITAIPLVASGEALPAEGSEVIVA-GWGRTSDGTN--SYKIRQISLKVAPEATCLDAY-- 182
            .:.:.||:|:.|.:...:......:|.|| |||||||.::  :..::.:.|.|.....|...|  
  Fly   136 TSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGT 200

  Fly   183 SDHDEQSFCLAHELKEGTCHGDGGGGAIY--GNTLIGLTNFVVGA-CGSRYPDVFVRLSSYADWI 244
            |...:.:.|:|....:.||:||.||..:.  .:..||||:|...| |...||..|.|::||.|||
  Fly   201 SVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265

  Fly   245 Q 245
            :
  Fly   266 K 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 66/227 (29%)
Tryp_SPc 42..244 CDD:214473 64/224 (29%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 69/241 (29%)
Tryp_SPc 38..268 CDD:238113 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.