DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and yip7

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:236 Identity:68/236 - (28%)
Similarity:107/236 - (45%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GRIMGGEDADATATTFTASLRVDN---AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVG 85
            |||..|:||.|....:...|...:   :..|||||:....:||.|||.  ||    |:.:....|
  Fly    38 GRITNGKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIGNEWVLTAAHCT--DG----AASVTIYYG 96

  Fly    86 STNQYAG--GKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVA-SGEALPAEG 145
            :|.:.:.  .::|:......|..|  ..:.|::::|..|| ::::..:..|.|.| |......||
  Fly    97 ATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLIQTSS-VSFSATVNKISLPAVSNSYSTYEG 160

  Fly   146 SEVIVAGWGRTSDGTN--SYKIRQISLKVAPEATCLDAYSD--HDEQSFCLAHELKEGTCHGDGG 206
            ...:.:|||.|||...  |..::.:.|.:...:.|.:.:..  ...:..|:....|..||.||.|
  Fly   161 KTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKCQETFGSLIVTSRVLCVDTTNKASTCQGDSG 225

  Fly   207 GGAIYGNTLIGLTNF-VVGACGSRYPDVFVRLSSYADWIQE 246
            |.......|||.|:| ....|.|..|..|.|::.|.|||:|
  Fly   226 GPLALDGVLIGATSFGSADGCESGAPAAFTRITYYRDWIKE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/218 (28%)
Tryp_SPc 42..244 CDD:214473 58/214 (27%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 64/231 (28%)
Tryp_SPc 40..267 CDD:238113 66/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.