DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG10477

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:241 Identity:78/241 - (32%)
Similarity:110/241 - (45%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GRIMGGEDADATATTFTASLRVDN---AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVG 85
            |||..|..|.|....:...|...:   :..|||||::.|.:||.|||..      .||.:....|
  Fly    38 GRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTK------GASSVTIYYG 96

  Fly    86 STNQYAG--GKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRIT--AIPLVASGEALPAE 144
            ||.:.:.  .|.|:......|..|  ..|.|::::|...| :|:|..|.  |:|.:||..:..| 
  Fly    97 STVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKTPS-VTFTVSINKIALPAIASSYSTYA- 159

  Fly   145 GSEVIVAGWGRTSD-----GTNSYKIRQISLKVAPEATCLDAYSDHDEQS--FCLAHELKEGTCH 202
            |...:.:|||||||     .||   ::....:|...|.|...:......|  .|:....|:.||.
  Fly   160 GQTAVASGWGRTSDSSIAVATN---LQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQ 221

  Fly   203 GDGGGGAIYGNTLIGLTNFVVG-ACGSRYPDVFVRLSSYADWIQEQ 247
            ||.||.....|.|||:|:||.. .|....|..|.|::||.|||:.|
  Fly   222 GDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 71/221 (32%)
Tryp_SPc 42..244 CDD:214473 69/218 (32%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 74/235 (31%)
Tryp_SPc 40..267 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471071
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.