DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG3650

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:262 Identity:79/262 - (30%)
Similarity:128/262 - (48%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATT------FTASLRVDNAHVCGGSILSQT 59
            ::|...::|||    |.|  ..|.||:||     |.||      |..:||.|....||||:::.:
  Fly     7 LLQLTQLLLGL----ASG--QIQPRIVGG-----TTTTLSAVGGFVVNLRYDGTFYCGGSLVTSS 60

  Fly    60 KILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYY---NLNNNLAVITLSS 121
            .::|.|||:    |...|||:..:.|.:.....|.:..|....: |:.:   :||.::.||.|.|
  Fly    61 HVVTAAHCL----KGYQASRITVQGGVSKLSQSGVVRRVARYFI-PNGFSSSSLNWDVGVIRLQS 120

  Fly   122 ELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTN--SYKIRQISLKVAPEATCLDAYSD 184
            .||.:. ||.|||.   :.....|:.:.|:|||.|..|.:  |.::|.:.:::..:..|..||..
  Fly   121 ALTGSG-ITTIPLC---QVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQG 181

  Fly   185 HD---EQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQE 246
            .|   ..:|| |....:.:|.||.|||.|:.|.|.|:.::.:|...::||.|:..:.....:|..
  Fly   182 RDTLTASTFC-ARTGGKDSCSGDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFILR 245

  Fly   247 QI 248
            .|
  Fly   246 SI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 63/212 (30%)
Tryp_SPc 42..244 CDD:214473 62/209 (30%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 70/232 (30%)
Tryp_SPc 26..243 CDD:238113 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.