DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG15873

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:285 Identity:71/285 - (24%)
Similarity:109/285 - (38%) Gaps:60/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTF------------------TASLRVDN- 47
            ||...|.||||  .:..:..|...::|    |.:..||                  ..|:|..| 
  Fly     1 MQILTVFLGLI--LSTSLSDADLGVIG----DISDETFEMLISGGYKPKSNRLSRHVVSIRTKNY 59

  Fly    48 ------AHVCGGSILSQTKILTTAHCV---------HRDGKLI--DASRLACRVGSTNQYAGGKI 95
                  .|.|.|.::|...:||.|||:         .|..:::  ..:|||.       |.....
  Fly    60 VRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAV-------YDESDF 117

  Fly    96 VNVESVAVHPDYYNL-NNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRT-SD 158
            .:|:.:.|||:|... .|:||::.| ||...:.....:||:....|....|...|..|||:. ..
  Fly   118 RSVDRLVVHPEYERYKKNDLAILRL-SERVQSSNHDVLPLLMRKTANVTYGDTCITLGWGQIYQH 181

  Fly   159 GTNSYKIRQISLKVAPEATCLDAY----SDHDEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLT 219
            |..|.::..:.:.:.|.:.|...|    :||   :.|.....:...|.||.||..:....|.||.
  Fly   182 GPYSNELVYLDVILRPPSLCQKHYDTFTADH---NVCTEPVGESMNCAGDMGGPLLCKGALFGLI 243

  Fly   220 NFVVGACGSRYPDVFVRLSSYADWI 244
            ...:|..|.:... |:....|.|||
  Fly   244 GGHMGCAGGKAMK-FLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/227 (26%)
Tryp_SPc 42..244 CDD:214473 57/225 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 53/224 (24%)
Tryp_SPc 59..250 CDD:238113 50/201 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.