DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG32269

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:229 Identity:68/229 - (29%)
Similarity:110/229 - (48%) Gaps:18/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGST 87
            |.||:||.....:.|.:...|| ..:::|.||::::..:||.||||    |...||....|.|:|
  Fly   106 QSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCV----KGYSASDFTVRGGTT 165

  Fly    88 N-QYAGGKIVNVESVAVHPDYYN--LNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVI 149
            . ..:.|...:|.|:.|.|.:.:  :|.:.|::.|:..||.|:    |..::.|...|..||.|.
  Fly   166 TLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTN----IGTISMGNYRPKAGSRVR 226

  Fly   150 VAGWGRTSDG--TNSYKIRQISLKVAPEATCLDAYSDH---DEQSFCLAHELKEGTCHGDGGGGA 209
            :||||.|.:|  |.|..::...::|..:..|...|...   .:...| |....:.:|.||.||..
  Fly   227 IAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLC-ARAAGKDSCSGDSGGPV 290

  Fly   210 IYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADW 243
            ...|||:|:.:|..|...:.||.|:..:.:...|
  Fly   291 TRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQW 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 62/210 (30%)
Tryp_SPc 42..244 CDD:214473 62/210 (30%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 66/225 (29%)
Tryp_SPc 121..324 CDD:238113 61/212 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.