DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG32270

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:242 Identity:65/242 - (26%)
Similarity:113/242 - (46%) Gaps:34/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGST-- 87
            ||:||..:|........::|......||||:::...:||.|||:: ||   :.|....|.|.|  
  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLN-DG---NPSDFVVRGGVTYL 90

  Fly    88 -----NQYAGGKIVNVESVAVHPDYYN---LNNNLAVITLSSELTYTDRITAIPLVASGEALPAE 144
                 ::|       |..:.: |..|:   |::::|::.|...|..:   .|.|:..:..: |..
  Fly    91 SDMRNSRY-------VRKILM-PSAYSRTTLDHDVALLQLKQPLQAS---IAKPISLAVRS-PRP 143

  Fly   145 GSEVIVAGWGRTSDGTNSY--KIRQISLKVAPEATCLDAYSDH---DEQSFCLAHELKEGTCHGD 204
            ||.|.|:|||.|...:.|.  :::.:.::|.|:..|.|.|..:   ....||.:....:..|.||
  Fly   144 GSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGD 208

  Fly   205 GGGGAIYGN-TLIGLTNF-VVGACGSR-YPDVFVRLSSYADWIQEQI 248
            .||..:..| .|:|:.:: ....|.:| .|.|:..:|..:|||.:.|
  Fly   209 SGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/222 (27%)
Tryp_SPc 42..244 CDD:214473 57/219 (26%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 62/236 (26%)
Tryp_SPc 31..254 CDD:238113 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.