DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG9897

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:276 Identity:68/276 - (24%)
Similarity:114/276 - (41%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTA 65
            |:.| |::|.::.|..:.:  ...||:.|...:.....:.||:.|::...|||:|:|:..|||.|
  Fly     1 MLAP-LILLQIVALPWLAL--GDQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAA 62

  Fly    66 HCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDR 128
            .||  ||  ..|..:..|:|:::....|.|..:..|.||..|  :..:||||::.....|..||.
  Fly    63 KCV--DG--YSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLNTTDE 123

  Fly   129 ITAIPLVASGEALPAEGSEVIVAGWG-------------RTSDGTNS------YKIRQISLKVAP 174
            |..|   ...:.:|.:.|...|.|.|             |.|.|...      .::....:::..
  Fly   124 IKPI---ERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILS 185

  Fly   175 EATC-----------LDAYSDHDEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGS 228
            :..|           |...||   .:.|.....| |.|..|.|...:..|.|:|:.:  ...|..
  Fly   186 QKQCAADWKVIPFYLLKGISD---LTICTKSPGK-GACSTDRGSPLVIDNKLVGILS--RAGCSI 244

  Fly   229 RYPDVFVRLSSYADWI 244
            : |||:..:..:.:|:
  Fly   245 K-PDVYANILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/235 (25%)
Tryp_SPc 42..244 CDD:214473 58/233 (25%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 62/249 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.