DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG32833

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:236 Identity:62/236 - (26%)
Similarity:105/236 - (44%) Gaps:29/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYA 91
            :||...:.|...:.||:.:.....|.|:|...:.|:|...||  ||.|....|:  |||||.:..
  Fly    39 LGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCV--DGFLNKVIRV--RVGSTTRSD 99

  Fly    92 GGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGW- 153
            |...|.|.::.||..:  ..:.:|:|::.|...|..:..|..|.|   ...||:.|::|...|| 
  Fly   100 GVIEVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQL---ANQLPSNGAKVTANGWP 161

  Fly   154 --------GRTSDGTNSYKIRQISLKVAPEATCLDAYSDHD-------EQSFCLAHELKEGTCHG 203
                    .:......:||:::..:|:...:.|.|.::.::       :..||.....|| .|..
  Fly   162 SFRWWAMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKFAKE-ACSL 225

  Fly   204 DGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244
            ..|...::...|:|:  ...|.| |.||:|::.|..|.||:
  Fly   226 AMGSPVVHNGKLVGI--ITKGGC-SEYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/221 (26%)
Tryp_SPc 42..244 CDD:214473 57/219 (26%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 62/235 (26%)
Tryp_SPc 40..262 CDD:214473 60/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.