DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG11192

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:259 Identity:67/259 - (25%)
Similarity:124/259 - (47%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDG 72
            ::.|:...........|||:|||.|......:..|:::...|:|||:|:....:||.|||.....
  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPW 74

  Fly    73 KLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLV 135
            ...|   ...||||:...:||.::::..|..|.||  .:.:|:||::.|:.:|.:|:.:..:||.
  Fly    75 SSAD---YTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLA 136

  Fly   136 ASGEALPAEGSEVIVAGWGRTSDGTN-------SYKIRQISLKVAPEATCLDAYSD---HDEQSF 190
            |..:. |...:.:.|:|||..::.:.       |.::|.:.:.:.....|..|||.   ...:..
  Fly   137 ALADP-PTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMI 200

  Fly   191 CLAHELKEGTCHGDGGGGAI-YG-----NTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248
            |.|...:: :|.||.||..: |.     ..|.|:.::.:|.....:|.|:..::::..||.||:
  Fly   201 CAARPGRD-SCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/222 (26%)
Tryp_SPc 42..244 CDD:214473 55/219 (25%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 61/236 (26%)
Tryp_SPc 28..262 CDD:238113 62/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.