DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Ser8

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:119/250 - (47%) Gaps:27/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAH 66
            ::|:...||             |||:||..:......:..||:...:|.|||||:|...|:|.||
  Fly    24 LEPQTSSLG-------------GRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAH 75

  Fly    67 CVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLN---NNLAVITLSSELTYTDR 128
            |:...   ...|.|..|.||..:..||.:|.|.::..| :.||.|   |::.|:.|.::||:...
  Fly    76 CLDTP---TTVSNLRIRAGSNKRTYGGVLVEVAAIKAH-EAYNSNSKINDIGVVRLKTKLTFGST 136

  Fly   129 ITAIPLVASGEALPAEGSEVIVAGWGRTS-DGTNSYKIRQISLKVAPEATCLDA---YSDHDEQS 189
            |.||.:.:   |.||.||...::|||:|| ||.:|..:..:..::...:.|..:   |....:.:
  Fly   137 IKAITMAS---ATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKAT 198

  Fly   190 FCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244
            ...|....:..|.||.||..:.|..|:|:.::......:.||.|:..::...||:
  Fly   199 MICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 64/209 (31%)
Tryp_SPc 42..244 CDD:214473 63/208 (30%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 67/225 (30%)
Tryp_SPc 35..253 CDD:238113 66/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.