DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and gammaTry

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:230 Identity:72/230 - (31%)
Similarity:120/230 - (52%) Gaps:18/230 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTN 88
            |||:||.....::..:..||:...:|.|||||.|...|:|.|||:    :.:.||.|..|.||:.
  Fly    29 GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL----QSVSASVLQIRAGSSY 89

  Fly    89 QYAGGKIVNVESVAVHPDYYNLN---NNLAVITLSSELTYTDRITAIPLVASGEALPAEGSEVIV 150
            ..:||...:|.|...| :.||.|   |::|:|.::..||::..|.||.|.:|.   ||.|:...|
  Fly    90 WSSGGVTFSVSSFKNH-EGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN---PANGAAASV 150

  Fly   151 AGWGRTSDGTNSY--KIRQISLKVAPEATCLDAYSDHDEQ----SFCLAHELKEGTCHGDGGGGA 209
            :|||..|.|::|.  :::.:::.:..::.|..:...:..|    ..|.|...|: .|.||.||..
  Fly   151 SGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKD-ACQGDSGGPL 214

  Fly   210 IYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244
            :.|..|:|:.::..|...|.||.|:..:::...|:
  Fly   215 VSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 67/212 (32%)
Tryp_SPc 42..244 CDD:214473 66/210 (31%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 70/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.