DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and thetaTry

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:265 Identity:71/265 - (26%)
Similarity:124/265 - (46%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLVIL-----------GLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRV-DNAHVCGGSILS 57
            |||:|           |.:|::.......:|||:||||....|..:..||:. ..:|.||||:::
  Fly     3 RLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLIN 67

  Fly    58 QTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYN--LNNNLAVITLS 120
            :..::|.|||:  .|:.:  |::..|:|||....||.:|.|..:|.:.||.:  :..::.::.|.
  Fly    68 EDTVVTAAHCL--VGRKV--SKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLD 128

  Fly   121 SELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSY--------KIRQISLKVAPEAT 177
            .::..|:.|..|.|...   .|..|:..:|.||     |:..|        .::::.:.:....|
  Fly   129 EKVKETENIRYIELATE---TPPTGTTAVVTGW-----GSKCYFWCMTLPKTLQEVYVNIVDWKT 185

  Fly   178 CLD---AYSDHDEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSS 239
            |..   .|.:....|...|:|.|:..|.||.||....||||:|:.::......:..|.|:..:.:
  Fly   186 CASDEYKYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPA 250

  Fly   240 YADWI 244
            ...||
  Fly   251 LRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/217 (26%)
Tryp_SPc 42..244 CDD:214473 55/215 (26%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 62/232 (27%)
Tryp_SPc 35..255 CDD:238113 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.