DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG12133

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:268 Identity:68/268 - (25%)
Similarity:114/268 - (42%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IMGGEDADATATTFTASLRVD-------NAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACR 83
            |:||.:|.:....:|..|..:       .:.:|.||:::...:||.|||::.:...:...||...
  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEH 126

  Fly    84 -VGSTNQYA----GGKI-------VNVESVAVHPDYYNLN----NNLAVITLSSELTYTDRITAI 132
             ..:...|.    |.||       ::|:....|..||..|    |::|::.|.|.:.||.:|..|
  Fly   127 DTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPI 191

  Fly   133 PL-------VASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYS----DHD 186
            .:       .:|.:..|.:     :||||.:.....|..:||.::.......||:.|.    |.|
  Fly   192 CIWPGIELSTSSFKNFPFQ-----IAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKD 251

  Fly   187 EQSFCLAHELKEGTCHGDG----------GGGAIYGNTLIGLTNFVVGACGSRY-PDVFVRLSSY 240
            .|...:..   :||..|.|          |.||.....|.|:|::..|.....| |.|:.:.|||
  Fly   252 IQICAMGW---DGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSY 313

  Fly   241 ADWIQEQI 248
            .:||:::|
  Fly   314 YEWIKKKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 62/249 (25%)
Tryp_SPc 42..244 CDD:214473 60/246 (24%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 67/265 (25%)
Tryp_SPc 62..317 CDD:214473 65/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.