DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and scaf

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:255 Identity:64/255 - (25%)
Similarity:104/255 - (40%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GMC---HAQGRIMGGEDADATATTFTASLRV----DNAHVCGGSILSQTKILTTAHCVHRDGKLI 75
            |:|   :.:.:..|.:|.||..........:    ....:|||:|:....:|::|.||  :|..:
  Fly   410 GVCATRNKRTKPTGVKDLDANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCV--NGLPV 472

  Fly    76 DASRLAC---RVGSTNQYAGGKIVNVESVAVHPDYYNLNN--NLAVITLSSELTYTDRITAIPLV 135
            ...|:..   .:||||:....::..|::|.|||||....|  :||:|.|...|.:...|.  |:.
  Fly   473 TDIRVKAGEWELGSTNEPLPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQ--PIC 535

  Fly   136 ASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSD--HDEQSFCLAHELKE 198
            .|.|. |.:..:...:|||:     .:..|.:....:....|...|.|:  .|..|.|.|  .|.
  Fly   536 ISDED-PKDSEQCFTSGWGK-----QALSIHEEGALMHVTDTLPQARSECSADSSSVCSA--TKF 592

  Fly   199 GTCHGDGGGGAIYGN-TLIGLTNFVVG--ACGS----RY--PDVFVRLSSYADWIQEQIA 249
            .:|..|.|.....|: :.:.|.....|  :||.    |:  ||:        .||....|
  Fly   593 DSCQFDVGSALACGSGSSVRLKGIFAGENSCGEGQTVRFAKPDI--------KWINTAFA 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/224 (25%)
Tryp_SPc 42..244 CDD:214473 55/221 (25%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 51/199 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.