DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG4650

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:288 Identity:68/288 - (23%)
Similarity:113/288 - (39%) Gaps:88/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGLTAV--------------GMCHAQGRIMGGEDADATATTFTASLRVDN-AHVCGGSILSQTK 60
            :||::|:              |.|   |.:..|:.|:..::.:.|.|.... .:||||:::::..
  Fly     5 VIGISALLFLLPVPGSSQYLDGRC---GLLTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKL 66

  Fly    61 ILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVN--------VESVAVHPDYYNLN---NNL 114
            :||.|||...      :.:|..|:|   ::.|....|        |....:| ..||..   |::
  Fly    67 VLTAAHCTRA------SEQLVARIG---EFIGTDDANDTMLSEYQVSQTFIH-SLYNTTTSANDI 121

  Fly   115 AVITLSSELTYTDRITAIPL--------------VASGEALPAEGSEVIVAGWGRTSDGTNSYKI 165
            |::.|::::.::..|..|.:              |.||            |.||..:|...|...
  Fly   122 AILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSG------------AQWGLPNDRNESDAF 174

  Fly   166 RQISLKVAPEATC--LDAYSDHDEQSFCLAHELKEGTCHGDGGG--GAI--YGN----TLIGL-- 218
            |...::..|...|  |:..:....| || |.:.....|:.|...  |||  :.|    .|||:  
  Fly   175 RITDIRRQPANMCSTLNGTAILSSQ-FC-AGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT 237

  Fly   219 TNFVVGAC--GSRYPDVFVRLSSYADWI 244
            ||   ..|  .|.|.||.    |:.|:|
  Fly   238 TN---QKCKRASVYTDVL----SHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/243 (24%)
Tryp_SPc 42..244 CDD:214473 58/241 (24%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 61/255 (24%)
Tryp_SPc 33..258 CDD:304450 61/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.