DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Send2

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:247 Identity:68/247 - (27%)
Similarity:116/247 - (46%) Gaps:20/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQPRLVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAH 66
            :|..|::|.|..|:|..:...:.||:||:........:..|::.|..|:|||||.|...|:|.||
  Fly     3 IQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAH 67

  Fly    67 CVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITA 131
            ||...|..:       |.||..:.:.|.:|:|.::..|.   .|.|::|::.||..|.:|:::..
  Fly    68 CVQGQGYQV-------RAGSALKNSNGSVVDVAAIRTHE---GLGNDIAIVRLSKPLEFTNQVQP 122

  Fly   132 IPLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHEL 196
            |||..:.   |..||...|:|||.:|..::...::.::|.:.     ...|....|.|...|...
  Fly   123 IPLAKTN---PPPGSIAFVSGWGSSSYYSHPIDLQGVNLYIQ-----WPYYCGLTEPSRICAGSF 179

  Fly   197 KEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248
            ....|.||.||..::...|:|:.:.....|  .|..::..:..:.:||...|
  Fly   180 GRAACKGDSGGPLVFDQQLVGVVSGGTKDC--TYSSIYTSVPYFREWILNAI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/204 (28%)
Tryp_SPc 42..244 CDD:214473 55/201 (27%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 59/218 (27%)
Tryp_SPc 27..225 CDD:238113 58/217 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.