DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Phae2

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:256 Identity:66/256 - (25%)
Similarity:109/256 - (42%) Gaps:59/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRV--- 84
            :||::||:.|.|.:..:..|::....|.|..:|::...::|.|||:....:::.::.:|..:   
  Fly    29 EGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVA 93

  Fly    85 --GSTNQ------------YAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIPLV 135
              .||.|            |.||.:          .|     ::.:|...:..|:|..:..:.|.
  Fly    94 GTASTTQKRQITHYVINDLYTGGTV----------PY-----DIGLIYTPTAFTWTAAVAPVKLP 143

  Fly   136 ASGEALPAEGSEVIVAGWGRTSDGTNS----------YKIRQISLKVAPEATCLDAY----SDHD 186
            :|| ..|...:::.  |||.||. |||          ..|..|||.     :|..|.    .|..
  Fly   144 SSG-VRPTGKADLF--GWGSTSK-TNSPSYPKTLQEAKNIPIISLD-----SCAAALGSKGQDVH 199

  Fly   187 EQSFCLAHELKEGT--CHGDGGGGAIYGNTLIGLTNFVVGACGS-RYPDVFVRLSSYADWI 244
            ..:.|.. .|..||  |..|.||..:.||.|||:.::....||. ..|.|:|::||:..||
  Fly   200 TTNLCTG-PLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 60/237 (25%)
Tryp_SPc 42..244 CDD:214473 58/235 (25%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 63/252 (25%)
Tryp_SPc 32..262 CDD:238113 64/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.