DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Phae1

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:123/277 - (44%) Gaps:55/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHR 70
            |::||:..::.|.:...:||::||..|...:..:..|::....|.|..|||:...::|.|||:..
  Fly    16 LLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCLTN 80

  Fly    71 DGKLIDASRLACRV-----GSTNQ------------YAGGKIVNVESVAVHPDYYNLNNNLAVIT 118
            ..:::.::.:|..:     .||.|            |.||.:          .|     ::.:|.
  Fly    81 SNQVLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTV----------PY-----DIGMIY 130

  Fly   119 LSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTS-DGTNSYKIRQISLKVAPE------A 176
            ..:...::..:..:.|.:|| .:|...:.:.  |||.|| ..|.||   ..:|:||..      :
  Fly   131 TPTAFVWSAAVAPVTLPSSG-VVPTGTANLY--GWGSTSTTNTASY---PSTLQVATNVPIISLS 189

  Fly   177 TCLDAY----SDHDEQSFCLAHELKEGT--CHGDGGGGAIYGNTLIGLTNFVVGACG-SRYPDVF 234
            :|..|.    ||....:.|.. .|..|.  |..|.||..:.||.|||:.::....|| :..|.|:
  Fly   190 SCESALGTKGSDVHSTNLCTG-PLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVY 253

  Fly   235 VRLSSYADWI--QEQIA 249
            |::||:..||  .:|::
  Fly   254 VQVSSFISWISANQQVS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/237 (25%)
Tryp_SPc 42..244 CDD:214473 57/232 (25%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 61/249 (24%)
Tryp_SPc 36..266 CDD:238113 62/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.