DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Jon25Biii

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:245 Identity:59/245 - (24%)
Similarity:98/245 - (40%) Gaps:47/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGS- 86
            :|||..|..|......:|..|.......|||||::...:||..||:.      ||:.:....|: 
  Fly    34 EGRITNGYAAPEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIG------DAASVIVYFGAT 92

  Fly    87 -------TNQYAGGKIVNVESVAV------HPDYYNLNNNLAVITLSSEL-TYTDRITAIPLVAS 137
                   |:....|..:...:..:      |.|::::.|.:       || :|.||..       
  Fly    93 WRTNAQFTHTVGNGNFIKHSNADIALIRIPHVDFWHMVNKV-------ELPSYNDRYN------- 143

  Fly   138 GEALPAEGSE--VIVAGWGRTSDGTNSYK-IRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEG 199
                  ..:|  .:..|||.|.||:.... ::.:.|::.....|...|....:...|......:.
  Fly   144 ------NYNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYGSVGDNVICTRTVDGKS 202

  Fly   200 TCHGDGGGGAIY--GNTLIGLTNFV-VGACGSRYPDVFVRLSSYADWIQE 246
            .|.||.||..:.  |:.|:|::||| ...|.|..|..|.|::.:.|||::
  Fly   203 ICGGDSGGPLVTHDGSKLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWIRD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 53/226 (23%)
Tryp_SPc 42..244 CDD:214473 51/222 (23%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 56/239 (23%)
Tryp_SPc 37..253 CDD:238113 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.