DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG11911

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:250 Identity:53/250 - (21%)
Similarity:106/250 - (42%) Gaps:43/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AQGRIMGGEDADATATTFTASLRVD---NAHVCGGSILSQTKILTTAHCVHR--DGKLIDASRLA 81
            |.|.::.|.:|:..:..:..||..:   ::|:|||:::::..|:|.|||:..  ...:|......
  Fly    33 ATGFVINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTR 97

  Fly    82 CRVGSTNQYAGGKIVNVESVAVHPDY------YNLNNNLAVITLSSELTYTDRITAIPLVASGEA 140
            ..|....|..     .|:...||..|      |    ::|::.::....:.:.:.  |.......
  Fly    98 AEVDELTQQR-----QVDFGRVHEKYTGGVGPY----DIALLHVNESFIFNEWVQ--PATLPSRE 151

  Fly   141 LPAEGSEVIVAGWGRTSDGTNSY------KIRQISLKVAPEATCLDAYSDH---DEQSFCLAH-E 195
            ...|| |..:.|||:    ..||      .::.::.::.....|.:...:.   .|.:.|.:. :
  Fly   152 QVHEG-ETHLYGWGQ----PKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQ 211

  Fly   196 LKEGTCHGDGGGGAIYGNT-----LIGLTNFVVGACG-SRYPDVFVRLSSYADWI 244
            ..:..|:||.||..:...|     |||:.::....|| :..|.::.::|:|.|||
  Fly   212 QSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 48/229 (21%)
Tryp_SPc 42..244 CDD:214473 47/228 (21%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 50/245 (20%)
Tryp_SPc 37..266 CDD:214473 49/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.