DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG1304

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:250 Identity:89/250 - (35%)
Similarity:131/250 - (52%) Gaps:14/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VILGLIGLTAVGMCHA-----QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAH 66
            ::||...|......|:     .||::|||||.........|||...:|.|||||||:..:||.||
  Fly     8 ILLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAH 72

  Fly    67 CV-HRDGK----LIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYT 126
            || ::|..    .|.|.|...|.||.::::||.:|.|..|.||.:|.|..|::|::.|.|.|..:
  Fly    73 CVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILS 137

  Fly   127 DRITAIPLVASGEALPAEGSEVIVAGWGRTS-DGTNSYKIRQISLKVAPEATCLDAYSDHDEQSF 190
            ..|..|.|..:.  .||: .:||::||||.. .|.....::..:||......|.:......:...
  Fly   138 ASIQPIDLPTAD--TPAD-VDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWGVQSEL 199

  Fly   191 CLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245
            ||.||...|.|:||.||.|:|.|.::|:..||..|||:.|||.:.|:..:.:||:
  Fly   200 CLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 78/209 (37%)
Tryp_SPc 42..244 CDD:214473 76/207 (37%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 82/224 (37%)
Tryp_SPc 32..256 CDD:238113 83/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.