DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Prss53

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:298 Identity:66/298 - (22%)
Similarity:118/298 - (39%) Gaps:83/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QPRLVILGLI----GLTAVGMCHAQ----------GRIMGGEDADATATTFTASLRVDNAHVCGG 53
            :|.|:|:|.:    ||.|......|          |..:.||      ..:.||:|....|:|.|
Mouse     6 RPELLIVGAVVVIEGLQAAQRACGQRGPGPPEPQEGNTLPGE------WPWQASVRRQGVHICSG 64

  Fly    54 SILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYA---GGKIVNVESVAVHPDY--YNLNNN 113
            |:::.|.:||.|||..:.. ..:.|..:..:||..|..   |.:.|.|.::.:...|  |:..::
Mouse    65 SLVADTWVLTAAHCFEKMA-TAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSD 128

  Fly   114 LAVITLSSELTYTDRITAIPLVASGEALPAE------GSEVIVAGWGR-TSDGTNSYKIRQISLK 171
            ||::    :||:       |.|.:...||..      |:.....||.: |||.:.:  :|.:.|:
Mouse   129 LALL----QLTH-------PTVQTTLCLPQPTYHFPFGASCWATGWDQNTSDVSRT--LRNLRLR 180

  Fly   172 VAPEATCLDAYSDHDEQSFCLAHEL---------------------KEGTCHGDGGGGAIY---- 211
            :....||           .||.:.|                     ::|.|.||.||..:.    
Mouse   181 LISRPTC-----------NCLYNRLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPD 234

  Fly   212 GNTL-IGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248
            |:.: :|:.:|.........|.:...::.::.|:|..:
Mouse   235 GHWVQVGIISFTSKCAQEDTPVLLTDMAVHSSWLQAHV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 54/242 (22%)
Tryp_SPc 42..244 CDD:214473 52/239 (22%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 2/18 (11%)
Tryp_SPc 45..271 CDD:238113 57/256 (22%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.