DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Prss34

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:264 Identity:62/264 - (23%)
Similarity:116/264 - (43%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDN------AHVCGGSILSQTKILTTAHCV 68
            ||:|            |:||....|:...:..|||:.:      .|.||||::....:||.||||
Mouse    31 GLVG------------IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCV 83

  Fly    69 HRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNL-----NNNLAVITLSSELTYTDR 128
            .  .|.::|..:..:||....|...:::.|..:..||.:...     ..::|::.|.:.:..::.
Mouse    84 R--PKEVEAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEH 146

  Fly   129 ITAIPLVASGEALPAEGSEVIVAGWGRTSDG---TNSYKIRQISLKVAPEATCLDAY---SDHDE 187
            :..:.|.|:...:.:: ....|||||...:.   ...|.:|::::.:.....|...|   |..|.
Mouse   147 VYPVSLPAASLRISSK-KTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDS 210

  Fly   188 QSFCLAHEL----KEG--TCHGDGGGGAI----YGNTLIGLTNFVVGACG-SRYPDVFVRLSSYA 241
            .:..:..::    |||  :|..|.||..:    .....:|:.::.:| || ..:|.|:.|:.||.
Mouse   211 TTRIIKDDMLCAGKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIG-CGLPDFPGVYTRVMSYV 274

  Fly   242 DWIQ 245
            .||:
Mouse   275 SWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 55/232 (24%)
Tryp_SPc 42..244 CDD:214473 53/229 (23%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 58/246 (24%)
Tryp_SPc 35..277 CDD:214473 57/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.