DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and psh

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:256 Identity:68/256 - (26%)
Similarity:110/256 - (42%) Gaps:50/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IMGGEDADATA---------TTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLA 81
            |:||...|...         .||....|      ||||:::...:||.||||:.|..    :...
  Fly   144 IVGGYPVDPGVYPHMAAIGYITFGTDFR------CGGSLIASRFVLTAAHCVNTDAN----TPAF 198

  Fly    82 CRVGSTN----QYAGGKIVNVESVAVHPDYY-NLNNNLAVITLSSELTYTDRITAIPLVASGEAL 141
            .|:|:.|    .::...|| :.||.:||.|. |..|::|::.|..::..||.|.  |.....:|.
  Fly   199 VRLGAVNIENPDHSYQDIV-IRSVKIHPQYVGNKYNDIAILELERDVVETDNIR--PACLHTDAT 260

  Fly   142 -PAEGSEVIVAGWG--RTSDGTNSYKIRQISLKVAPEATCLDAYSDH------------DEQSFC 191
             |...|:..|||||  ..:....|..:.:..|::.|...|..:|::.            |.....
  Fly   261 DPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLLKQGVIDSLLCA 325

  Fly   192 LAHELKEGTCHGDGGGGAIYG-------NTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245
            :..:|....|.||.||..|:.       .|::|:.:...| |.:..|.::.|:|||.|:|:
  Fly   326 IDQKLIADACKGDSGGPLIHELNVEDGMYTIMGVISSGFG-CATVTPGLYTRVSSYLDFIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 62/231 (27%)
Tryp_SPc 42..244 CDD:214473 61/228 (27%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 67/253 (26%)
Tryp_SPc 144..387 CDD:238113 68/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.