DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG9676

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:244 Identity:84/244 - (34%)
Similarity:125/244 - (51%) Gaps:5/244 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHR 70
            |::|...|:.|......:.||:||..|.........|||...:|.|||||:|:..::|.||||.:
  Fly     8 LLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLRRRGSHTCGGSIISKDYVVTAAHCVKQ 72

  Fly    71 DGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIPLV 135
            ...:..|:.|..:.||....:||..|.|.:|.|||:|.:..:::||:.|.:.||:...|.||.|.
  Fly    73 GNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGHDVAVLRLRNSLTFNSNIAAIKLA 137

  Fly   136 ASGEALPAEGSEVIVAGWGRTSD-GTNSYKIRQISLKVAPEATCLDAY-SDHDEQSFCLAHELKE 198
            ...   |...:.|.::|||..|. |..|..:..:.:|.....:|...| ....|.:.||.|...:
  Fly   138 TED---PPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETTMCLLHPKDK 199

  Fly   199 GTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQ 247
            |.|:||.||.|.|...|:||.:||:|.||...||.:.|:|...:||.|:
  Fly   200 GACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNWIAEK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 74/206 (36%)
Tryp_SPc 42..244 CDD:214473 72/203 (35%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 77/220 (35%)
Tryp_SPc 28..248 CDD:238113 78/222 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 1 1.000 - - otm47449
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.