DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG31220

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:269 Identity:73/269 - (27%)
Similarity:110/269 - (40%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GMCHAQGRIMGGEDADATATTFTASLRVDNAHV----------CGGSILSQTKILTTAHCVHRDG 72
            |......|::||.:.:.....:.|.|...|...          ||||:::...:||.||||....
  Fly    96 GKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTV 160

  Fly    73 KLIDASRLACRVGSTNQ---YAGGKIV--------NVESVAVHPDY----YNLNNNLAVITLSSE 122
            ..|...||.....|.|.   ..|.:||        :|||:..|.||    |...|::|::.|...
  Fly   161 LQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEP 225

  Fly   123 LTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTS-DGTNSYKIRQISLKVAPEATCLDAYSD-H 185
            :.||  :...|:............::.|||||:|. ..|.|..::..::||.....|.:.|:. |
  Fly   226 VRYT--MAYYPICVLDYPRSLMKFKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRH 288

  Fly   186 DEQSF--CLAHELKEGTCHGDGG------GGAIYGNT--LIGLTNFVVGACGS-RYPDVFVRLSS 239
            ....|  |.......|||.||.|      .|..|...  |.|:|:: .|.||: .:|.||.|.:.
  Fly   289 FGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSY-GGPCGTIGWPSVFTRTAK 352

  Fly   240 YADWIQEQI 248
            :..||:..:
  Fly   353 FYKWIRAHL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 68/242 (28%)
Tryp_SPc 42..244 CDD:214473 66/239 (28%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 70/256 (27%)
Tryp_SPc 104..360 CDD:238113 71/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.