DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Tmprss11g

DIOPT Version :10

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_796136.2 Gene:Tmprss11g / 320454 MGIID:2444058 Length:417 Species:Mus musculus


Alignment Length:73 Identity:15/73 - (20%)
Similarity:32/73 - (43%) Gaps:6/73 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 IVHFVIG----AMTVILCARLFIMYLTAKSEVTKFLS--QATRVALLDSLTIFTFFILPSFAYAQ 159
            |||...|    ...:::.|.:.:|:...:.:|..|:|  :..|..|:.:...::|.......:..
Mouse   314 IVHCSAGVGRTGTFIVIDAMMDMMHAEGRLDVFGFVSRIRKQRCQLIQTDMQYSFIYQALLEHYL 378

  Fly   160 FPATDFEI 167
            |..|:.:|
Mouse   379 FGDTELDI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 15/73 (21%)
Tmprss11gNP_796136.2 SEA 48..146 CDD:460188
Tryp_SPc 186..414 CDD:238113 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.