DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG33159

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:260 Identity:61/260 - (23%)
Similarity:115/260 - (44%) Gaps:50/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGLTAV-GMCH---------AQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTA 65
            ::||..: .:||         ::.||:||::...:...:...||.:...:||||::|...:|:.|
  Fly     1 MVGLRLLWWLCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAA 65

  Fly    66 HCVHRDGKLIDASRLACRVGSTNQ----YAGGKIVNVESVAVH--------PDY--YNLNNNLAV 116
            |||:               ||..:    :||...::.|:..|.        |.|  .|.:.::|:
  Fly    66 HCVY---------------GSQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDMDVAL 115

  Fly   117 ITLSSELTYT-DRITAIPLVASGEALPAEGSEVI-VAGWGRTSDGTN--SYKIRQISLKVAPEAT 177
            :.|...:..| .::..|....:    |.||:... ::|||.|.:...  :.::|...::|.|.|.
  Fly   116 LQLQEVVVLTPGKVATISPCRN----PPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAE 176

  Fly   178 CLDAYSDHDEQS---FCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSS 239
            |..:||.:.:.|   .|.|......:|.||.||..:|...:.|:.::..|.....:|.|:..::|
  Fly   177 CKISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWGFGCARPSFPGVYTNVAS 241

  Fly   240  239
              Fly   242  241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 53/219 (24%)
Tryp_SPc 42..244 CDD:214473 53/219 (24%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 56/234 (24%)
Tryp_SPc 26..251 CDD:238113 56/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.