DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG31269

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:262 Identity:84/262 - (32%)
Similarity:132/262 - (50%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAV-----------GMCHAQGRIMGGEDADATATTFTASLR-VDNAHVCGGSILSQ 58
            |::|||.||.::           |..:...||:||:.|:.....:..||: :..||.|||:|:::
  Fly     7 LILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINE 71

  Fly    59 TKILTTAHCVHRDGKLIDASRLACRVGSTNQY--AGGKIVNVESVAVHPDYYN--LNNNLAVITL 119
            |.:||.||||  :...|.   ....|..||:|  .||:.. ::::.:|.:|.|  ::|::|::.|
  Fly    72 TFVLTAAHCV--ENAFIP---WLVVVTGTNKYNQPGGRYF-LKAIHIHCNYDNPEMHNDIALLEL 130

  Fly   120 SSELTYTDRITAIPLVASGEALPAE-GSEVIVAGWGRT-SDGTNSYKIRQISLKVAPEATC---L 179
            ...:.:.:|...|||    ..:|.: |.|||:.|||.| ..||:...::.:.|:..|...|   |
  Fly   131 VEPIAWDERTQPIPL----PLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALL 191

  Fly   180 DAYSDHDEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVG-ACGSRYPDVFVRLSSYADW 243
            ....|.|....|....|.||.||||.||..:....|:||.|:  | .|.:..|||...:..|.||
  Fly   192 SNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNW--GWPCATGVPDVHASVYFYRDW 254

  Fly   244 IQ 245
            |:
  Fly   255 IR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 72/215 (33%)
Tryp_SPc 42..244 CDD:214473 70/212 (33%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/229 (33%)
Tryp_SPc 38..258 CDD:238113 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.