DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG32834

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:109/260 - (41%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLAC 82
            |...||.||:||.|.|.....:.|.:.:|...:|.|:|::...|:|.|.||...|.      :..
  Fly    19 GDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCVQSYGS------IEV 77

  Fly    83 RVG-STNQYAG-GKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVASGEALPA 143
            ||| |:..|.| |.::.|..:..||.|  :..:||||::.|...|..::   ||..::..|..|.
  Fly    78 RVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSE---AIQPISIAEDEPD 139

  Fly   144 EGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKE---------- 198
            :||...|:|||.|| ...|:..|           |..:..|:.:.::...:..::          
  Fly   140 DGSWCTVSGWGSTS-WWGSWWDR-----------CFGSLPDYLQMAWVSVYNREQCAADRGVWFG 192

  Fly   199 -----------------GTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQE 246
                             |.|..|.|...:....|:|:.:  .|.|.:: |||:..:..:..||.|
  Fly   193 LWDNGISYLTLCTHNGAGGCSYDTGAPLVIDGQLVGILS--EGGCTTK-PDVYANVPWFTGWIAE 254

  Fly   247  246
              Fly   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/236 (24%)
Tryp_SPc 42..244 CDD:214473 54/232 (23%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 61/249 (24%)
Tryp_SPc 27..255 CDD:238113 63/252 (25%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.