DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG32523

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:255 Identity:81/255 - (31%)
Similarity:120/255 - (47%) Gaps:16/255 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAV-GMCHAQG--------RIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKI 61
            :::|.|.|:..: |...||.        ||:||..|.........|||:...|.|||.|:|.|.:
  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHV 72

  Fly    62 LTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY-YNLNNNLAVITLSSELTY 125
            :|..|||.....::.|...:.:.||....:.|..:.|..|.:||:| ...:|:|||:.|.|.||:
  Fly    73 ITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTF 137

  Fly   126 TDRITAIPLVASGEALPAEGSEVIVAGWGRTSD-GTNSYKIRQISLKVAPEATC-LDAYSDHDEQ 188
            ...|.||.|....   |.....|.::|||..:: |..|..:..:.:.......| ...||...|.
  Fly   138 DANIAAIQLATED---PPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPET 199

  Fly   189 SFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVV-GACGSRYPDVFVRLSSYADWIQEQ 247
            ..||.|....|.|:||.||.|.||..::||.:.:: |.||...||.::|:|....||.|:
  Fly   200 MICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 69/208 (33%)
Tryp_SPc 42..244 CDD:214473 67/205 (33%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/222 (32%)
Tryp_SPc 37..219 CDD:238113 58/184 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.