DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and sphinx1

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:244 Identity:54/244 - (22%)
Similarity:91/244 - (37%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTA---------SLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRL 80
            ||.||    ..|.|||.         ..:..:.:...|:|:|...|||..       .::..|.:
  Fly    25 RIAGG----YRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVK-------TVLKYSYI 78

  Fly    81 ACRVGSTNQYAGGKIVNV--ESVAVHPDYYNLNNNLAVITLSSELTYTDRITAIPLVASGEALPA 143
            ...:.|...|.|..|:.:  |:...|.|    |:::..:.......:..|:..:       .:||
  Fly    79 EVHLASRRSYRGFDIIRIYKENFRFHYD----NDHVIALVKCPYQKFDRRMDRV-------RVPA 132

  Fly   144 --------EGSEVIVAGWGRTSDGTNSYK-IRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEG 199
                    .|:..:|.|:|.........: :|.|.::|.....|...|:.......|.:.|..:|
  Fly   133 YDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTPLKWYEMCTSGEGFKG 197

  Fly   200 TCHGDGGGGAIY---GNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245
            .|.||.||..:.   ..|.||:...:...|...||.|.:|:|.:..||:
  Fly   198 VCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIKWIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 46/218 (21%)
Tryp_SPc 42..244 CDD:214473 44/215 (20%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 52/241 (22%)
Tryp_SPc 26..248 CDD:304450 53/243 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.