DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and spirit

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:218 Identity:59/218 - (27%)
Similarity:92/218 - (42%) Gaps:41/218 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDYYNLNNNLA 115
            |||::::...:||.|||....|:.....||.   |.......|:.:::..|.:||||        
  Fly   163 CGGALIANNFVLTAAHCADLGGEPPSQVRLG---GDNLTLTEGEDISIRRVIIHPDY-------- 216

  Fly   116 VITLSSELTYTD-RITAIPLVASGEALPA------EGSEVIVA--GWGRTS-DGTNSYKIRQISL 170
                |:...|.| .:..:...|..|..|.      |.:..:|.  |:|:|| .|.:|.::.::.|
  Fly   217 ----SASTAYNDIALLELETAAKPELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPL 277

  Fly   171 KVAPEATCLDAYSDHDEQSFCLAHELKEG-------TCHGDGGGGAIYGNTLIGLTNFVVG---- 224
            |......|...|.........|..::..|       ||.||.||..:..:.|:|   :|||    
  Fly   278 KSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLG---YVVGITSL 339

  Fly   225 --ACGSRYPDVFVRLSSYADWIQ 245
              .|.|..|.|:.|:||:.|||:
  Fly   340 GQGCASGPPSVYTRVSSFVDWIE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/218 (27%)
Tryp_SPc 42..244 CDD:214473 57/215 (27%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 59/218 (27%)
Tryp_SPc 132..361 CDD:214473 57/215 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.