DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Klk10

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:267 Identity:64/267 - (23%)
Similarity:113/267 - (42%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGLTAVGMCHAQGRIMGG----EDADATAT-------TFTASLRVDNAHVCGGSILSQTKILTT 64
            |:.|..:.:..||..::.|    ||.:|..|       .:..||..:....|.|.::.|..:||.
  Rat    21 LLPLLMMQLWAAQALLLPGNTTREDLEAFGTLCPSVSQPWQVSLFHNLQFQCAGVLVDQNWVLTA 85

  Fly    65 AHCVHRDGKLIDASRLACRVGSTN--QYAGGKIVNVESVAVHPDYYNLN----------NNLAVI 117
            |||...       ..|..|||..:  .:...::.:..|...||.|...:          ::|.::
  Rat    86 AHCWRN-------KPLRARVGDDHLLLFQSEQLRSTNSPVFHPKYQPCSGPVLPLRSDEHDLMML 143

  Fly   118 TLSSELTYTDRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTNSYKIRQIS---LKVAPEATCL 179
            .|||.:..|.::..:.|.... |.|.:  |..|:|||.|::....|. |.:|   :.:..:..|.
  Rat   144 KLSSPVVLTSKVHPVQLPFQC-AQPRQ--ECQVSGWGTTANRRVKYN-RSLSCSRVTLLSQKQCE 204

  Fly   180 DAYSD-HDEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACG--SRYPDVFVRLSSYA 241
            ..|.. ......|...:..:.:|..|.||..:..|||.|:.::.:..||  ::||.|:.::.:|.
  Rat   205 TFYPGVITNNMICAGMDRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAATQYPAVYAKICNYT 269

  Fly   242 DWIQEQI 248
            :||:..|
  Rat   270 NWIRRVI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 54/222 (24%)
Tryp_SPc 42..244 CDD:214473 52/219 (24%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 53/232 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.