DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Prss38

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:249 Identity:63/249 - (25%)
Similarity:101/249 - (40%) Gaps:26/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASR 79
            :|.|.....|:::|||........:..|:.....||||||||:...:||.|||..|:.:|   ..
  Rat   103 SACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFAREKRL---QT 164

  Fly    80 LACRVGSTNQYAGGKIV---NVESVAVHPD---YYNLNNNLAVITLSSELTYTDRITAIPLVASG 138
            ....||.||.....|..   .:..|.:||.   ::.:..::|::...|.:.::|.:  :|:....
  Rat   165 FDMYVGITNLEVANKHTQWFEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFSDYV--LPICLPS 227

  Fly   139 EALPAEGSEVIVAGWGRTS-DGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKEG--- 199
            ..|..........|||..| .|.....:.:..|.:.|:..|...|.   ..|:.|...|..|   
  Rat   228 SNLNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYG---LTSYLLPEMLCAGDIK 289

  Fly   200 ----TCHGDGGGGAI--YGNT--LIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245
                .|.||.|...:  ...|  .||:.::..|.....||.||..:|.:.:||:
  Rat   290 NMKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWIR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/222 (26%)
Tryp_SPc 42..244 CDD:214473 55/219 (25%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 59/234 (25%)
Tryp_SPc 116..342 CDD:214473 58/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.