DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and Prss34

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:249 Identity:60/249 - (24%)
Similarity:112/249 - (44%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IMGGEDADATATTFTASLRVDN------AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRV 84
            |:||....|:...:..|||..|      .|:||||::....:||.||||  :.|.::||....:|
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCV--ELKEMEASCFRVQV 95

  Fly    85 GSTNQYAGGKIVNVESVAVHPDYYNL-----NNNLAVITLSSELTYTDRITAIPLVASGEALPAE 144
            |....|...:::.|..:..||.:...     ..::|::.|.|.:..::|:..:.|.|:.:.:.::
  Rat    96 GQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISSK 160

  Fly   145 GSEVIVAGWGRTSDGTNSY----KIRQISLKVAPEATCLDAYSDHD----------EQSFCLAHE 195
             ....||||| ..:|....    .:|::::.:...:.|...|..:.          :...|...|
  Rat   161 -KTWWVAGWG-VIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGME 223

  Fly   196 LKEGTCHGDGGGGAI----YGNTLIGLTNFVVGACG-SRYPDVFVRLSSYADWI 244
            .:: :|..|.||..:    .....:|:.::.:| || ..:|.|:.|:.||..||
  Rat   224 GRD-SCQADSGGPLVCRWNCSWVQVGVVSWGIG-CGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 56/233 (24%)
Tryp_SPc 42..244 CDD:214473 54/231 (23%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 60/249 (24%)
Tryp_SPc 33..275 CDD:214473 58/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.