DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG18420

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:117/267 - (43%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVILGLIGLTAV--GMCHAQG------RIMGGEDADATATTFTASLRV-DNAHVCGGSILSQTKI 61
            |.:..|:|.|..  ..|..:.      ||:.|:.|...::.:.|.|.. .|..:|||:::|:..:
  Fly    15 LTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRLV 79

  Fly    62 LTTAHCVHRDGKLIDASRLACRVGSTNQYAGG--KIVNVESVAVHPDYYNLN---NNLAVITLSS 121
            ||.|||      .|..:.:..|:|..|:...|  :...|.....| .:|:.|   |::|::.|.|
  Fly    80 LTAAHC------FIPNTTIVVRLGEYNRKLKGYREEHQVNRTFQH-RFYDPNTHANDIALLRLVS 137

  Fly   122 ELTYTDRITAIPLV--ASGEALPAEGSEVIV-AGWGRTSDGTNSYKIRQISLKVAPEATCLDAYS 183
            .:.|...|..|.::  ||.:. ..:..:|:. .|||||....:|.::|.:.:...|...|  |:.
  Fly   138 NVVYKANIRPICIMWDASWKH-HIDSIKVLTGTGWGRTESMHDSSELRTLDISRQPSKMC--AFG 199

  Fly   184 DHDEQSFCLAHELKEGTCHGDGGG--GAI--YGNTL------IGLTNFVVGACGSRYPDVFVRLS 238
            ......|| |.......|.||.||  ||:  |.|..      |.:||   ..|  :.|.||..:.
  Fly   200 SVLSNQFC-AGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITN---KRC--QRPSVFTDVM 258

  Fly   239 SYADWIQ 245
            |:.::|:
  Fly   259 SHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 61/223 (27%)
Tryp_SPc 42..244 CDD:214473 60/220 (27%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 65/237 (27%)
Tryp_SPc 43..267 CDD:238113 65/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.