DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphe and CG18636

DIOPT Version :9

Sequence 1:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:251 Identity:60/251 - (23%)
Similarity:101/251 - (40%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIMGGEDADATATTFTASLR-VDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGS-- 86
            ||:.|..|...::.:...|. ..:..|||||:::...:||.|||      .|....|..|:|.  
  Fly    44 RIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITDKLVLTAAHC------FIANQHLVARLGEYE 102

  Fly    87 -------TNQYAGGKIVNVESVAVHPDYYNLN---NNLAVITLSSELTYTDRITAIPLVASG--- 138
                   |..|...:..::.........|:.|   |::|::.||..:.|.|.|..|.:|...   
  Fly   103 RTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWR 167

  Fly   139 ------EALPAEGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDH-DEQSFCLAHEL 196
                  :.|.|       .|||:|...::|..::.:.::..|...|....... ....|| |...
  Fly   168 HYLDKIDLLTA-------TGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFC-AGNW 224

  Fly   197 KEGTCHGDGGG--GAI--YGNT----LIGLTNFVVGACGSRYPDVFVRLSSYADWI 244
            ....|:||.||  ||:  :.||    .:|:.::....|  :...||..:.|:|::|
  Fly   225 DSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNC--QKASVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 56/234 (24%)
Tryp_SPc 42..244 CDD:214473 55/232 (24%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 59/249 (24%)
Tryp_SPc 45..278 CDD:238113 58/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.